PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G240500.1.p
Common NameLOC101772396, SETIT_024114mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 279aa    MW: 27914.3 Da    PI: 7.4999
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G240500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.83.7e-4341138198
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC++dCv+apyfp e+p+kf  vh++FGasnv+k+l++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+q++
  Seita.3G240500.1.p  41 PCAACKFLRRKCQPDCVFAPYFPPENPQKFVHVHRVFGASNVTKILNELHPCQREDAVNSLAYEADMRLRDPVYGCVGVISILQHRLRQVQ 131
                         7****************************************************************************************** PP

              DUF260  92 aelallk 98 
                         +ela++ 
  Seita.3G240500.1.p 132 QELARAS 138
                         ***9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.96540141IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-4341137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MAASSASSVP PASTGSVVTV VSPSTGGGSI SGSLGAGAGS PCAACKFLRR KCQPDCVFAP  60
YFPPENPQKF VHVHRVFGAS NVTKILNELH PCQREDAVNS LAYEADMRLR DPVYGCVGVI  120
SILQHRLRQV QQELARASYE LSKYQAAAEA AAAAAASVAV GSNGAAAAGM ADFVGNPVPN  180
CTQNFINVGH PTAAAAIGGA GFVQHDHFAS VQMLARSYDG EAATARLGMN GGGGGYGFAY  240
SSAMGAGHGV VSGVGQIGGG PFLKSGTAGG DEQPAAAQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955601e-111AY795560.1 Triticum aestivum AS2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962077.10.0PREDICTED: LOB domain-containing protein 6-like
RefseqXP_004962078.10.0PREDICTED: LOB domain-containing protein 6-like
RefseqXP_004962079.10.0PREDICTED: LOB domain-containing protein 6-like
RefseqXP_012700131.10.0PREDICTED: LOB domain-containing protein 6-like
SwissprotQ32SG31e-115LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLK3ZC400.0K3ZC40_SETIT; Uncharacterized protein
STRINGSi024114m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-51LBD family protein